CHCHD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2107681
| Article Name: |
CHCHD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2107681 |
| Supplier Catalog Number: |
orb2107681 |
| Alternative Catalog Number: |
BYT-ORB2107681-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHCHD1 |
| Conjugation: |
Biotin |
| Alternative Names: |
C2360, MRP-S37, C10orf34 |
| CHCHD1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
13 |
| NCBI: |
976043 |
| UniProt: |
Q96BP2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS |
