FAM36A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107729
Article Name: FAM36A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107729
Supplier Catalog Number: orb2107729
Alternative Catalog Number: BYT-ORB2107729-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A
Conjugation: Biotin
Alternative Names: FAM36A, MC4DN11
FAM36A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 932342
UniProt: Q5RI15
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN