LRRC56 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107732
Article Name: LRRC56 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107732
Supplier Catalog Number: orb2107732
Alternative Catalog Number: BYT-ORB2107732-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC56
Conjugation: Biotin
Alternative Names: CILD39, DNAAF12
LRRC56 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 932341
UniProt: Q8IYG6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL