PRELID2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107756
Article Name: PRELID2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107756
Supplier Catalog Number: orb2107756
Alternative Catalog Number: BYT-ORB2107756-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRELID2
Conjugation: Biotin
Alternative Names: FLJ38376, MGC21644
PRELID2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 892005
UniProt: Q8N945
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE