C13orf30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107774
Article Name: C13orf30 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107774
Supplier Catalog Number: orb2107774
Alternative Catalog Number: BYT-ORB2107774-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C13orf30
Conjugation: Biotin
Alternative Names: C13orf30
C13orf30 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 872314
UniProt: Q8N7L0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY