CCDC38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107786
Article Name: CCDC38 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107786
Supplier Catalog Number: orb2107786
Alternative Catalog Number: BYT-ORB2107786-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC38
Conjugation: Biotin
Alternative Names: FLJ40089
CCDC38 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 872302
UniProt: Q502W7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE