Ubxn2a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107798
Article Name: Ubxn2a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107798
Supplier Catalog Number: orb2107798
Alternative Catalog Number: BYT-ORB2107798-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: Biotin
Alternative Names: Ubxd4
Ubxn2a Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 001102952
UniProt: D3ZID8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE