WDR49 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107849
Article Name: WDR49 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107849
Supplier Catalog Number: orb2107849
Alternative Catalog Number: BYT-ORB2107849-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR49
Conjugation: Biotin
Alternative Names: FLJ33620
WDR49 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 849146
UniProt: Q8IV35
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY