LRRC50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107861
Article Name: LRRC50 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107861
Supplier Catalog Number: orb2107861
Alternative Catalog Number: BYT-ORB2107861-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC50
Conjugation: Biotin
Alternative Names: swt, DAU1, ODA7, CILD13, LRRC50
LRRC50 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 848547
UniProt: Q8NEP3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVLNTL