KLC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107894
Article Name: KLC3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107894
Supplier Catalog Number: orb2107894
Alternative Catalog Number: BYT-ORB2107894-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLC3
Conjugation: Biotin
Alternative Names: KLC2, KLCt, KLC2L, KNS2B
KLC3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 803136
UniProt: Q6P597
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL