FBXO36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2107966
Article Name: FBXO36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2107966
Supplier Catalog Number: orb2107966
Alternative Catalog Number: BYT-ORB2107966-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO36
Conjugation: Biotin
Alternative Names: Fbx36
FBXO36 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 777559
UniProt: Q8NEA4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILD