CCDC117 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2108023
Article Name: CCDC117 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2108023
Supplier Catalog Number: orb2108023
Alternative Catalog Number: BYT-ORB2108023-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC117
Conjugation: Biotin
Alternative Names: dJ366L4.1
CCDC117 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 775781
UniProt: Q8IWD4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNT