CCDC138 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2108758
Article Name: CCDC138 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2108758
Supplier Catalog Number: orb2108758
Alternative Catalog Number: BYT-ORB2108758-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC138
Conjugation: Biotin
Alternative Names: FLJ32745
CCDC138 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 659415
UniProt: Q96M89
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG