ARHGAP36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2108773
Article Name: ARHGAP36 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2108773
Supplier Catalog Number: orb2108773
Alternative Catalog Number: BYT-ORB2108773-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP36.
Conjugation: Biotin
Alternative Names: FLJ30058, RP13-102H20.1
ARHGAP36 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 659404
UniProt: Q6ZRI8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH