TEKT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2108803
Article Name: TEKT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2108803
Supplier Catalog Number: orb2108803
Alternative Catalog Number: BYT-ORB2108803-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TEKT4
Conjugation: Biotin
Alternative Names: MGC27019
TEKT4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 653306
UniProt: Q8WW24
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQ