FAM83F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109046
Article Name: FAM83F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109046
Supplier Catalog Number: orb2109046
Alternative Catalog Number: BYT-ORB2109046-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM83F
Conjugation: Biotin
FAM83F Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55
NCBI: 612444
UniProt: Q8NEG4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQDIVDAACKRRVPV