LOC296884 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2109048
Article Name: LOC296884 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109048
Supplier Catalog Number: orb2109048
Alternative Catalog Number: BYT-ORB2109048-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat LOC296884
Conjugation: FITC
Alternative Names: RGD1563612
LOC296884 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 001170913
UniProt: B2RYK0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PPESQDGSPCSTEDLLYDRDKDSGSSSPLPKYASSPKPNNSYMFKREPPE