GLCCI1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2109050
Article Name: GLCCI1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109050
Supplier Catalog Number: orb2109050
Alternative Catalog Number: BYT-ORB2109050-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLCCI1
Conjugation: HRP
Alternative Names: GCTR, GIG18, TSSN1, FAM117C
GLCCI1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58
NCBI: 612435
UniProt: Q86VQ1
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD