C1QTNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109304
Article Name: C1QTNF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109304
Supplier Catalog Number: orb2109304
Alternative Catalog Number: BYT-ORB2109304-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1QT2
Conjugation: Biotin
Alternative Names: CTRP2, zacrp2
C1QTNF2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
UniProt: Q9BXJ5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQ