TRIB1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2109324
Article Name: TRIB1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109324
Supplier Catalog Number: orb2109324
Alternative Catalog Number: BYT-ORB2109324-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIB1
Conjugation: FITC
Alternative Names: C8FW, GIG2, TRB1, GIG-2, SKIP1, TRB-1
TRIB1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 079471
UniProt: Q96RU8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF