CSH2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2109341
Article Name: CSH2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109341
Supplier Catalog Number: orb2109341
Alternative Catalog Number: BYT-ORB2109341-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSH2
Conjugation: HRP
Alternative Names: PL, CSB, CS-2, GHB1, hCS-B
CSH2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 14
NCBI: 072171
UniProt: B1A4H9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH