CRYGC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2109366
Article Name: CRYGC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109366
Supplier Catalog Number: orb2109366
Alternative Catalog Number: BYT-ORB2109366-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRYGC
Conjugation: FITC
Alternative Names: CCL, CRYG3, CTRCT2
CRYGC Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 066269
UniProt: P07315
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE