ADD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109382
Article Name: ADD2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109382
Supplier Catalog Number: orb2109382
Alternative Catalog Number: BYT-ORB2109382-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADD2
Conjugation: Biotin
Alternative Names: ADDB
ADD2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 001608
UniProt: P35612
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VVNGREEEQTAEEILSKGLSQMTTSADTDVDTSKDKTESVTSGPMSPEGS