DNM1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109436
Article Name: DNM1L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109436
Supplier Catalog Number: orb2109436
Alternative Catalog Number: BYT-ORB2109436-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L
Conjugation: Biotin
Alternative Names: DLP1, DRP1, DVLP, EMPF, OPA5, EMPF1, DYMPLE, HDYNIV
DNM1L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 036192
UniProt: O00429
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG