UTP14A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109619
Article Name: UTP14A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109619
Supplier Catalog Number: orb2109619
Alternative Catalog Number: BYT-ORB2109619-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human UTP14A
Conjugation: Biotin
Alternative Names: Utp14, NYCO16, SDCCAG16, dJ537K23.3
UTP14A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 88
NCBI: 006640
UniProt: Q9BVJ6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL