RIDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109790
Article Name: RIDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109790
Supplier Catalog Number: orb2109790
Alternative Catalog Number: BYT-ORB2109790-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human UK114
Conjugation: Biotin
Alternative Names: PSP, P14.5, UK114, HRSP12, hp14.5
RIDA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 005827
UniProt: P52758
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: INDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTA