RABEPK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109796
Article Name: RABEPK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109796
Supplier Catalog Number: orb2109796
Alternative Catalog Number: BYT-ORB2109796-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RABEPK
Conjugation: Biotin
Alternative Names: p40, RAB9P40, bA65N13.1
RABEPK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40
NCBI: 005824
UniProt: Q7Z6M1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL