DCAF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109802
Article Name: DCAF7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109802
Supplier Catalog Number: orb2109802
Alternative Catalog Number: BYT-ORB2109802-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF7
Conjugation: Biotin
Alternative Names: AN11, HAN11, WDR68, SWAN-1
DCAF7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 005819
UniProt: P61962
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLEC