RCAN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2109811
Article Name: RCAN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2109811
Supplier Catalog Number: orb2109811
Alternative Catalog Number: BYT-ORB2109811-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of HUMAN RCAN2
Conjugation: Biotin
Alternative Names: CSP2, RCN2, MCIP2, ZAKI4, ZAKI-4, DSCR1L1
RCAN2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 26kDa
UniProt: Q14206
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPE