CENPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110030
Article Name: CENPB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110030
Supplier Catalog Number: orb2110030
Alternative Catalog Number: BYT-ORB2110030-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CENPB
Conjugation: Biotin
CENPB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 001801
UniProt: P07199
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK