DGKQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110069
Article Name: DGKQ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110069
Supplier Catalog Number: orb2110069
Alternative Catalog Number: BYT-ORB2110069-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DGKQ
Conjugation: Biotin
Alternative Names: DAGK, DAGK4, DAGK7
DGKQ Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 101kDa
NCBI: 001338
UniProt: P52824
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ