Ap1g1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110114
Article Name: Ap1g1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110114
Supplier Catalog Number: orb2110114
Alternative Catalog Number: BYT-ORB2110114-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Ap1g1
Conjugation: Biotin
Alternative Names: Adt, Adtg, AA409002, AU041323, AW551707, D8Ertd374, D8Ertd374e
Ap1g1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 033807
UniProt: Q8CBB7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL