COPA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110159
Article Name: COPA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110159
Supplier Catalog Number: orb2110159
Alternative Catalog Number: BYT-ORB2110159-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPA
Conjugation: Biotin
Alternative Names: AILJK, HEP-COP, alpha-COP
COPA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 135kDa
NCBI: 004362
UniProt: P53621
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD