CFAP221 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110234
Article Name: CFAP221 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110234
Supplier Catalog Number: orb2110234
Alternative Catalog Number: BYT-ORB2110234-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PCDP1
Conjugation: Biotin
Alternative Names: PCDP1, FAP221
CFAP221 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
UniProt: Q4G0U5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SHPKYKFTKESRHGSSIPVTQKQFLHHTDIIPGIMHWKSFQSLVLSSLPD