LIPJ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110291
Article Name: LIPJ Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110291
Supplier Catalog Number: orb2110291
Alternative Catalog Number: BYT-ORB2110291-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LIPJ
Conjugation: Biotin
Alternative Names: LIPL1, bA425M17.2
LIPJ Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 001010939
UniProt: Q5W064
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI