DYSFIP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110324
Article Name: DYSFIP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110324
Supplier Catalog Number: orb2110324
Alternative Catalog Number: BYT-ORB2110324-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DYSFIP1
Conjugation: Biotin
Alternative Names: DYSFIP1
DYSFIP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 001007534
UniProt: Q86WC6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD