DCK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110354
Article Name: DCK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110354
Supplier Catalog Number: orb2110354
Alternative Catalog Number: BYT-ORB2110354-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DCK
Conjugation: Biotin
Alternative Names: MGC117410, MGC138632
DCK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 000779
UniProt: P27707
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD