CYP27A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110360
Article Name: CYP27A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110360
Supplier Catalog Number: orb2110360
Alternative Catalog Number: BYT-ORB2110360-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CP27A
Conjugation: Biotin
Alternative Names: CTX, CP27, CYP27
CYP27A1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 000775
UniProt: Q02318
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPE