ADH5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110372
Article Name: ADH5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110372
Supplier Catalog Number: orb2110372
Alternative Catalog Number: BYT-ORB2110372-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADH5
Conjugation: Biotin
Alternative Names: FDH, ADHX, ADH-3, AMEDS, BMFS7, FALDH, GSNOR, GSH-FDH, HEL-S-60p
ADH5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 000662
UniProt: P11766
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSGKSIRTVV