ABAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110378
Article Name: ABAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110378
Supplier Catalog Number: orb2110378
Alternative Catalog Number: BYT-ORB2110378-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABAT
Conjugation: Biotin
Alternative Names: GABAT, NPD009, GABA-AT
ABAT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 065737
UniProt: P80404
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT