ZNF90 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110408
Article Name: ZNF90 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110408
Supplier Catalog Number: orb2110408
Alternative Catalog Number: BYT-ORB2110408-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF90
Conjugation: Biotin
Alternative Names: HTF9
ZNF90 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 934768
UniProt: Q03938
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KDSFQKVIVTRYEKREYGNLELKKGCESVDEGKVHKRGYNGLNQCLTATQ