FUBP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110414
Article Name: FUBP3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110414
Supplier Catalog Number: orb2110414
Alternative Catalog Number: BYT-ORB2110414-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUBP3
Conjugation: Biotin
Alternative Names: FBP3
FUBP3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 003925
UniProt: Q96I24
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SIPHLNNSTPLVDPSVYGYGVQKRPLDDGVGNQLGALVHQRTVITEEFKV