ZNF486 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110501
Article Name: ZNF486 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110501
Supplier Catalog Number: orb2110501
Alternative Catalog Number: BYT-ORB2110501-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF486
Conjugation: Biotin
Alternative Names: KRBO2
ZNF486 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 443084
UniProt: Q96H40
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HKIIHTGEQPYKCKECDKAFNHPATLSSHKKIHTGEKPYTCDKCGKAFIS