INTS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110507
Article Name: INTS4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110507
Supplier Catalog Number: orb2110507
Alternative Catalog Number: BYT-ORB2110507-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INTS4
Conjugation: Biotin
Alternative Names: INT4, MST093
INTS4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 108kDa
NCBI: 291025
UniProt: Q96HW7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGL