ARID5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2110561
Article Name: ARID5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2110561
Supplier Catalog Number: orb2110561
Alternative Catalog Number: BYT-ORB2110561-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARID5A
Conjugation: Biotin
Alternative Names: MRF1, MRF-1, RP11-363D14
ARID5A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 997646
UniProt: Q03989
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE