PTDSS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112350
Article Name: PTDSS2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112350
Supplier Catalog Number: orb2112350
Alternative Catalog Number: BYT-ORB2112350-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS2
Conjugation: HRP
Alternative Names: PSS2
PTDSS2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 110410
UniProt: Q9BVG9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE