CLPTM1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112353
Article Name: CLPTM1L Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112353
Supplier Catalog Number: orb2112353
Alternative Catalog Number: BYT-ORB2112353-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CLPTM1L
Conjugation: HRP
Alternative Names: CRR9
CLPTM1L Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 110409
UniProt: Q96KA5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD