C12orf49 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112494
Article Name: C12orf49 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112494
Supplier Catalog Number: orb2112494
Alternative Catalog Number: BYT-ORB2112494-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human C12orf49
Conjugation: HRP
Alternative Names: LUR1, POST1, SPRING, C12orf49
C12orf49 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 079014
UniProt: Q9H741
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKV