ACBD4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112500
Article Name: ACBD4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112500
Supplier Catalog Number: orb2112500
Alternative Catalog Number: BYT-ORB2112500-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACBD4
Conjugation: HRP
Alternative Names: HMFT0700
ACBD4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 078998
UniProt: Q8NC06
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQAT