RGD1305007 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112509
Article Name: RGD1305007 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112509
Supplier Catalog Number: orb2112509
Alternative Catalog Number: BYT-ORB2112509-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1305007
Conjugation: HRP
Alternative Names: RGD1305007
RGD1305007 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 001013998
UniProt: Q5M843
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RFEGCTPRKCGRGVTDIVITREEAEQIRRIAEKGLSLGGSDGGASILDLH